PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim01g010600.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 244aa    MW: 28291.7 Da    PI: 6.5837
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim01g010600.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.4e-1876127556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++++ eq+++Le  Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Sopim01g010600.0.1  76 RRLNMEQVKTLEMNFELGNKLESERKIQLARALGLQPRQVAIWFQNRRARWK 127
                         57899**********************************************9 PP

2HD-ZIP_I/II120.31e-3874165293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         k rrl+ eqvk+LE++Fe  +kLe+erK +lar+Lglqprqva+WFqnrRAR+ktkqlEk y++Lkr++d +k++ne+L +++++L++e++
  Sopim01g010600.0.1  74 KIRRLNMEQVKTLEMNFELGNKLESERKIQLARALGLQPRQVAIWFQNRRARWKTKQLEKHYDVLKREFDVIKSQNEALLAHNNKLQAEIM 164
                         669************************************************************************************9997 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Sopim01g010600.0.1 165 T 165
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.22869129IPR001356Homeobox domain
SuperFamilySSF466891.03E-1870131IPR009057Homeodomain-like
SMARTSM003896.4E-1772133IPR001356Homeobox domain
CDDcd000861.31E-1473130No hitNo description
PfamPF000463.1E-1576127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-1877136IPR009057Homeodomain-like
PRINTSPR000311.0E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5109125IPR000047Helix-turn-helix motif
PfamPF021837.2E-14129168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MTSCNNEMDF FPTNLMQHTP HEDNHQDHFH GVTSFLGKRS MSFSSKCDDQ NHGDQEDVLS  60
DDGTHHEAIL REKKIRRLNM EQVKTLEMNF ELGNKLESER KIQLARALGL QPRQVAIWFQ  120
NRRARWKTKQ LEKHYDVLKR EFDVIKSQNE ALLAHNNKLQ AEIMTLKNGK GPTESINLNK  180
ETDQGSICST RSENSTEIMK LQCNNMKLMD QTVKEETLSN IFCGIDDNSS GFWPWLDQQP  240
HFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKTKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2458350.0AC245835.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-8i3 map 1, complete sequence.
GenBankAC2467090.0AC246709.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-58g10 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004228394.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-78ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLK4ATQ40.0K4ATQ4_SOLLC; Uncharacterized protein
STRINGSolyc01g010600.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.18e-80HD-ZIP family protein